(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBJ

CT978603.PSBJ        Location/Qualifiers
FT   CDS             complement(210513..210713)
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="SynRCC307_0207"
FT                   /product="Photosystem II reaction center J protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27110"
FT                   /db_xref="GOA:A5GQF1"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF1"
FT                   /protein_id="CAK27110.1"
FT                   /translation="MSGKKSGLPDGRVPDRNPDGTPAVPWKSRWTEGPLPLWLVATAGG
FT                   MAVMFVVGLFFYGSYVGVGSA"
     MSGKKSGLPD GRVPDRNPDG TPAVPWKSRW TEGPLPLWLV ATAGGMAVMF VVGLFFYGSY        60
     VGVGSA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page