(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBM

CT978603.PSBM        Location/Qualifiers
FT   CDS             401343..401453
FT                   /transl_table=11
FT                   /gene="psbM"
FT                   /locus_tag="SynRCC307_0420"
FT                   /product="Photosystem II reaction center M protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27323"
FT                   /db_xref="GOA:A5GR14"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GR14"
FT                   /protein_id="CAK27323.1"
FT                   /translation="MVMETNDLGFVATLLFVLVPAIFLIILYIQTNSREG"
     MVMETNDLGF VATLLFVLVP AIFLIILYIQ TNSREG                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page