(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBX

CT978603.PSBX        Location/Qualifiers
FT   CDS             332772..332894
FT                   /transl_table=11
FT                   /gene="psbX"
FT                   /locus_tag="SynRCC307_0343"
FT                   /product="Photosystem II PsbX protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27246"
FT                   /db_xref="GOA:A5GQT7"
FT                   /db_xref="InterPro:IPR009518"
FT                   /db_xref="InterPro:IPR023431"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQT7"
FT                   /protein_id="CAK27246.1"
FT                   /translation="MTPSLANFLNSLVAGALIVVVPITIALILISQTDQVDRKL"
     MTPSLANFLN SLVAGALIVV VPITIALILI SQTDQVDRKL                              40
//

If you have problems or comments...

PBIL Back to PBIL home page