(data stored in ACNUC29543 zone)

EMBL: CT978603.RADA

CT978603.RADA        Location/Qualifiers
FT   CDS             248917..250308
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="SynRCC307_0251"
FT                   /product="DNA repair protein RadA"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27154"
FT                   /db_xref="GOA:A5GQJ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQJ5"
FT                   /protein_id="CAK27154.1"
FT                   /translation="MPRTVTTYVCQNCGAQSRQFFGRCSSCGSWNSLVEQTSGPPPDGR
FT                   RRRQSAEAAEPAPRRSEAMAAVGERAVQRLGTGFAELDRVLGGGLVPGSLVLVGGDPGI
FT                   GKSTLLLQTAADLAQRQSVLYVSAEESAQQVKLRWQRLAAAGSDGDGPQLLAETDLEHV
FT                   LQELEALRPDVAVIDSIQALHDADLSSAPGSVAQVRECAASLQRLAKKLDIALLLVGHV
FT                   TKEGMLAGPKVLEHLVDAVLTFEGDRFASHRLLRAVKNRFGATHELGVFEMRDRGLLEV
FT                   SNPSELFLGSPEGSVGMATIVACEGTRPLVVELQALVSTTSYASPRRMATGIGTNRLHQ
FT                   ILAVLEKHLGLPLSRFDCYLAVAGGLEVEEPAADLGVAAAVVASFRDLALPAGTVLVGE
FT                   LGLGGQLRPVGQLELRLQEAARLGFRRAVVPKGSGVSCPELAIEEASGIAEALVAALGV
FT                   NPADD"
     MPRTVTTYVC QNCGAQSRQF FGRCSSCGSW NSLVEQTSGP PPDGRRRRQS AEAAEPAPRR        60
     SEAMAAVGER AVQRLGTGFA ELDRVLGGGL VPGSLVLVGG DPGIGKSTLL LQTAADLAQR       120
     QSVLYVSAEE SAQQVKLRWQ RLAAAGSDGD GPQLLAETDL EHVLQELEAL RPDVAVIDSI       180
     QALHDADLSS APGSVAQVRE CAASLQRLAK KLDIALLLVG HVTKEGMLAG PKVLEHLVDA       240
     VLTFEGDRFA SHRLLRAVKN RFGATHELGV FEMRDRGLLE VSNPSELFLG SPEGSVGMAT       300
     IVACEGTRPL VVELQALVST TSYASPRRMA TGIGTNRLHQ ILAVLEKHLG LPLSRFDCYL       360
     AVAGGLEVEE PAADLGVAAA VVASFRDLAL PAGTVLVGEL GLGGQLRPVG QLELRLQEAA       420
     RLGFRRAVVP KGSGVSCPEL AIEEASGIAE ALVAALGVNP ADD                         463
//

If you have problems or comments...

PBIL Back to PBIL home page