(data stored in ACNUC29543 zone)

EMBL: CT978603.RPLT

CT978603.RPLT        Location/Qualifiers
FT   CDS             complement(54293..54640)
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="SynRCC307_0059"
FT                   /product="50S ribosomal protein L20"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26962"
FT                   /db_xref="GOA:A5GQ03"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ03"
FT                   /protein_id="CAK26962.1"
FT                   /translation="MARVKRGNVARNRRNKILRLARGFQGSNGTLFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARMNGVSYSRLIGGLKKADVRINRKMLAQLAVLDPS
FT                   GFETVVAAAKS"
     MARVKRGNVA RNRRNKILRL ARGFQGSNGT LFRTANQRVM KALCNAYRDR RRRKRDFRRL        60
     WIARINAAAR MNGVSYSRLI GGLKKADVRI NRKMLAQLAV LDPSGFETVV AAAKS            115
//

If you have problems or comments...

PBIL Back to PBIL home page