(data stored in ACNUC29543 zone)

EMBL: CT978603.RSMB

CT978603.RSMB        Location/Qualifiers
FT   CDS             508390..509754
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="SynRCC307_0574"
FT                   /product="Ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27477"
FT                   /db_xref="GOA:A5GRG8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG8"
FT                   /protein_id="CAK27477.1"
FT                   /translation="MSKGRCPCGAICGHRSCPFVLSPDSAVGLPPRLVAWRVLEAVGDG
FT                   AYADLALERELKRSKLSPRDRGLATELAYGAIRQRRRLDGWLDLLGKVPAAKQPPRLRW
FT                   LLHVGLQQILLMDRVPASAAVSTAVELAKRERLQRLAPVVNGVLRAAVRAVEAGESLPV
FT                   PSDPQKRLALEHSLPDWLVAELWGQIGPERTEALAAASNRIPPLDLRCNRLRSSREALL
FT                   ENLPAVALAELPDGLTLTSRPGPLPQLAGFSEGQWCVQDRAAQRIAPLLDPKPGQRVLD
FT                   ACAAPGGKTTHIAELMGDQGEVVAVDVAPRRLQQVSANAERLGLSCIRTEAADATDLTD
FT                   WEAESFDRVLLDVPCSGLGTLARHADARWNLKPDGIEELVGLQHQLLEQGARLLKPDGR
FT                   LVYATCTVHPAENTGVVEAFVEENPDWQFSEPPMQLWPDPQGGDGFFAAVLSLRR"
     MSKGRCPCGA ICGHRSCPFV LSPDSAVGLP PRLVAWRVLE AVGDGAYADL ALERELKRSK        60
     LSPRDRGLAT ELAYGAIRQR RRLDGWLDLL GKVPAAKQPP RLRWLLHVGL QQILLMDRVP       120
     ASAAVSTAVE LAKRERLQRL APVVNGVLRA AVRAVEAGES LPVPSDPQKR LALEHSLPDW       180
     LVAELWGQIG PERTEALAAA SNRIPPLDLR CNRLRSSREA LLENLPAVAL AELPDGLTLT       240
     SRPGPLPQLA GFSEGQWCVQ DRAAQRIAPL LDPKPGQRVL DACAAPGGKT THIAELMGDQ       300
     GEVVAVDVAP RRLQQVSANA ERLGLSCIRT EAADATDLTD WEAESFDRVL LDVPCSGLGT       360
     LARHADARWN LKPDGIEELV GLQHQLLEQG ARLLKPDGRL VYATCTVHPA ENTGVVEAFV       420
     EENPDWQFSE PPMQLWPDPQ GGDGFFAAVL SLRR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page