(data stored in ACNUC29543 zone)

EMBL: CT978603.SALX

CT978603.SALX        Location/Qualifiers
FT   CDS             complement(596018..596695)
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="SynRCC307_0658"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27561"
FT                   /db_xref="GOA:A5GRQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ2"
FT                   /protein_id="CAK27561.1"
FT                   /translation="MGSNPVAELRHIHKVYGSGDTEVRAVNDLNLTVEAGDYIAVMGAS
FT                   GSGKSTAMNILGCLDRPSSGSYLLQGQQVDGLSDDALAILRNRCLGFVFQQFHLLGHLS
FT                   AQENVELPMVYANVPAEERQQRAVEALQRVGLGQRLRNKPNQLSGGQQQRVAIARAIIN
FT                   RPALLLADEPTGALDSETTADVLEIFDQLNGDGMTVVLVTHEHDVAERAKQRVLFRDGR
FT                   IAN"
     MGSNPVAELR HIHKVYGSGD TEVRAVNDLN LTVEAGDYIA VMGASGSGKS TAMNILGCLD        60
     RPSSGSYLLQ GQQVDGLSDD ALAILRNRCL GFVFQQFHLL GHLSAQENVE LPMVYANVPA       120
     EERQQRAVEA LQRVGLGQRL RNKPNQLSGG QQQRVAIARA IINRPALLLA DEPTGALDSE       180
     TTADVLEIFD QLNGDGMTVV LVTHEHDVAE RAKQRVLFRD GRIAN                       225
//

If you have problems or comments...

PBIL Back to PBIL home page