(data stored in ACNUC29543 zone)

EMBL: CT978603.SPPA

CT978603.SPPA        Location/Qualifiers
FT   CDS             complement(581584..582369)
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="SynRCC307_0644"
FT                   /product="Periplasmic serine proteases (ClpP class)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones / Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27547"
FT                   /db_xref="GOA:A5GRN8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRN8"
FT                   /protein_id="CAK27547.1"
FT                   /translation="MVWPLRRQRRKRIARISLTGPIAGAARKRVVKALRQVEERKFPVL
FT                   LLRIDSPGGTVGDSQEIHQALLRLRESGCQVVASYGNISASGGVYVGCAADRIVANAGT
FT                   ITGSIGVILRGNNLEKLLERVGIRFETVKSGLYKDILSPDKPLSEGERSILQALIDSSY
FT                   SQFVAAVAQGRKLSEETVRTFADGRVFSGAQALELGMVDLLGDEDTARREAARLAGLDE
FT                   EKSQPVELGKERAGLVQKLRQELQLQLAWGGQPLWLFRP"
     MVWPLRRQRR KRIARISLTG PIAGAARKRV VKALRQVEER KFPVLLLRID SPGGTVGDSQ        60
     EIHQALLRLR ESGCQVVASY GNISASGGVY VGCAADRIVA NAGTITGSIG VILRGNNLEK       120
     LLERVGIRFE TVKSGLYKDI LSPDKPLSEG ERSILQALID SSYSQFVAAV AQGRKLSEET       180
     VRTFADGRVF SGAQALELGM VDLLGDEDTA RREAARLAGL DEEKSQPVEL GKERAGLVQK       240
     LRQELQLQLA WGGQPLWLFR P                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page