(data stored in ACNUC29543 zone)

EMBL: CT978603.SUFE

CT978603.SUFE        Location/Qualifiers
FT   CDS             complement(654986..655408)
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="SynRCC307_0724"
FT                   /product="SufE-like protein, probably involved in Fe-S
FT                   center assembly"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27627"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW8"
FT                   /protein_id="CAK27627.1"
FT                   /translation="MASGSAALDTIVAKLKGSSDPKRRYEYVLWLAKKLPAPPAELSSD
FT                   ANRVRGCVSQVFVQPVVDGAVLHWQGDSDAQITKGLLALLIQGLDGLTPQQVMAVDPGF
FT                   IAETGLAASLTPSRANGFLNILRHMQAQAAALAGEG"
     MASGSAALDT IVAKLKGSSD PKRRYEYVLW LAKKLPAPPA ELSSDANRVR GCVSQVFVQP        60
     VVDGAVLHWQ GDSDAQITKG LLALLIQGLD GLTPQQVMAV DPGFIAETGL AASLTPSRAN       120
     GFLNILRHMQ AQAAALAGEG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page