(data stored in ACNUC29543 zone)

EMBL: CT978603.TATC

CT978603.TATC        Location/Qualifiers
FT   CDS             complement(637992..638771)
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="SynRCC307_0706"
FT                   /product="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /note="Intracellular trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27609"
FT                   /db_xref="GOA:A5GRV0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRV0"
FT                   /protein_id="CAK27609.1"
FT                   /translation="MSAIEPTPERDPDFPGEVEMSFADHLEELRWRLLRSLASVVIAAA
FT                   GCLVLVRPLVRLLEQPAEGMRFMQLAPGEFLFVSIKVAGYAGLTLALPYVLFEGLGFVL
FT                   PGLSRRERRLIAPAVAGSAVLFLLGLAFAWWALVPAALRFLMGYGADVVEPIWSIERYL
FT                   DFVLLLMLATGLSFQLPVLQLVLGSLGILNSKAMLSGWRLVVLLSALAGAVLTPSTDPV
FT                   TMLLLSGAITGLYLVGVGLVAFTEGIRSNAPGPATES"
     MSAIEPTPER DPDFPGEVEM SFADHLEELR WRLLRSLASV VIAAAGCLVL VRPLVRLLEQ        60
     PAEGMRFMQL APGEFLFVSI KVAGYAGLTL ALPYVLFEGL GFVLPGLSRR ERRLIAPAVA       120
     GSAVLFLLGL AFAWWALVPA ALRFLMGYGA DVVEPIWSIE RYLDFVLLLM LATGLSFQLP       180
     VLQLVLGSLG ILNSKAMLSG WRLVVLLSAL AGAVLTPSTD PVTMLLLSGA ITGLYLVGVG       240
     LVAFTEGIRS NAPGPATES                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page