(data stored in ACNUC29543 zone)

EMBL: CT978603.THIC

CT978603.THIC        Location/Qualifiers
FT   CDS             123610..125010
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SynRCC307_0129"
FT                   /product="Thiamine biosynthesis protein ThiC"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27032"
FT                   /db_xref="GOA:A5GQ73"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ73"
FT                   /protein_id="CAK27032.1"
FT                   /translation="MRSAWIEKRRGSANVSQLHYARQGVVTEEMAYVAKRENLPESLVM
FT                   EEVARGRMIIPANINHANLEPMAIGIASKCKVNANIGASPNASDASEEVKKLELAVKYG
FT                   ADTVMDLSTGGVNLDEVRTAIINASPVPIGTVPVYQALESVHGSIERLSEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRLTGIVSRGGGILAQWMLYHHKQNPLYTRFEDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDDAQLAELKTLGELTRRAWKHDVQVMVEGPGHVP
FT                   MDQIEFNVKKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNADDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDKDLESLEEVLKAKGGAELS
FT                   TAKLDRAD"
     MRSAWIEKRR GSANVSQLHY ARQGVVTEEM AYVAKRENLP ESLVMEEVAR GRMIIPANIN        60
     HANLEPMAIG IASKCKVNAN IGASPNASDA SEEVKKLELA VKYGADTVMD LSTGGVNLDE       120
     VRTAIINASP VPIGTVPVYQ ALESVHGSIE RLSEDDFLHI IEKHCQQGVD YQTIHAGLLI       180
     EHLPKVKGRL TGIVSRGGGI LAQWMLYHHK QNPLYTRFED ICEIFKRYDC TFSLGDSLRP       240
     GCQHDASDDA QLAELKTLGE LTRRAWKHDV QVMVEGPGHV PMDQIEFNVK KQMEECSEAP       300
     FYVLGPLVTD IAPGYDHITS AIGAAMAGWH GTAMLCYVTP KEHLGLPNAD DVREGLIAYK       360
     IAAHAADIAR HRPGARDRDD ELSRARYAFD WNKQFELSLD PERAKEYHDE TLPADIYKQA       420
     EFCSMCGPKH CPMQTKITDK DLESLEEVLK AKGGAELSTA KLDRAD                      466
//

If you have problems or comments...

PBIL Back to PBIL home page