(data stored in ACNUC29543 zone)

EMBL: CT978603.TIG

CT978603.TIG         Location/Qualifiers
FT   CDS             complement(62419..63894)
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SynRCC307_0067"
FT                   /product="Trigger factor"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26970"
FT                   /db_xref="GOA:A5GQ11"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ11"
FT                   /protein_id="CAK26970.1"
FT                   /translation="MTTALKVKTSSLPGSRLALEVGVPADRCKASYEAAVERLSRSVRL
FT                   PGFRKGRVPKPVLLQQIGPLRVKASALEDLVDSVLRDAVEQEKVEVLGQPSLSGNFEEL
FT                   LEKFDPAKELVVTLEMDVAPTPTLKSTKGLSAEAESVAYDPARVDELLDQSRRQLATLV
FT                   PVSDRAAAMGDVAVVSFSGVFSDDKSAIEGGSANGLDVELEEGRMISGFVEGVVGMKPG
FT                   DKKDVDCQFPDDYPEETCRGRKALFSISLDELKGRELPELDDAFAQQASDKKTLSELRE
FT                   DLENRLKQDAEQRQKNNRHEALLKALVDQLEVELPESLIKEEINSLLQETAAQMAQQGM
FT                   DVKKLFTPETVQNLAQASRGEATERLQRSLALKALAKAEGISVADKDLEAKIKEVSAGF
FT                   SDTNKIDPQRLRDAVAEDLLRETLLSWLEENAKLTMVDPASEDKPAKASKAKSSKAKAE
FT                   KEPAAEGQAKAKPAAKTSKSKTKAAEKLITPID"
     MTTALKVKTS SLPGSRLALE VGVPADRCKA SYEAAVERLS RSVRLPGFRK GRVPKPVLLQ        60
     QIGPLRVKAS ALEDLVDSVL RDAVEQEKVE VLGQPSLSGN FEELLEKFDP AKELVVTLEM       120
     DVAPTPTLKS TKGLSAEAES VAYDPARVDE LLDQSRRQLA TLVPVSDRAA AMGDVAVVSF       180
     SGVFSDDKSA IEGGSANGLD VELEEGRMIS GFVEGVVGMK PGDKKDVDCQ FPDDYPEETC       240
     RGRKALFSIS LDELKGRELP ELDDAFAQQA SDKKTLSELR EDLENRLKQD AEQRQKNNRH       300
     EALLKALVDQ LEVELPESLI KEEINSLLQE TAAQMAQQGM DVKKLFTPET VQNLAQASRG       360
     EATERLQRSL ALKALAKAEG ISVADKDLEA KIKEVSAGFS DTNKIDPQRL RDAVAEDLLR       420
     ETLLSWLEEN AKLTMVDPAS EDKPAKASKA KSSKAKAEKE PAAEGQAKAK PAAKTSKSKT       480
     KAAEKLITPI D                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page