(data stored in ACNUC29543 zone)

EMBL: CT978603.TMK

CT978603.TMK         Location/Qualifiers
FT   CDS             253136..253774
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SynRCC307_0254"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27157"
FT                   /db_xref="GOA:A5GQJ8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ8"
FT                   /protein_id="CAK27157.1"
FT                   /translation="MRGRFLVLEGIDGCGKTTQLKALADWLPASGLMPSGAQLITTREP
FT                   GGTALGQALRQLLLHPPEEQAPATRAELLLYAADRAQHVQTRLEPALAAGDWVLSDRYC
FT                   GSTAAYQGYGRGLDLDLITQLEQLATAGLQPDLCLWLELSPELAAQRRSGQQQDRIEAE
FT                   GLAFLARVHQGFAELSQRPLWRRVDASLPPEQVHQQVQHLVREGLELAL"
     MRGRFLVLEG IDGCGKTTQL KALADWLPAS GLMPSGAQLI TTREPGGTAL GQALRQLLLH        60
     PPEEQAPATR AELLLYAADR AQHVQTRLEP ALAAGDWVLS DRYCGSTAAY QGYGRGLDLD       120
     LITQLEQLAT AGLQPDLCLW LELSPELAAQ RRSGQQQDRI EAEGLAFLAR VHQGFAELSQ       180
     RPLWRRVDAS LPPEQVHQQV QHLVREGLEL AL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page