(data stored in ACNUC29543 zone)

EMBL: CT978603.UMUC

CT978603.UMUC        Location/Qualifiers
FT   CDS             40237..41517
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="SynRCC307_0043"
FT                   /product="Bacterial UmuC protein homolog (SOS-regulated
FT                   protein)"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26946"
FT                   /db_xref="GOA:A5GPY7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPY7"
FT                   /protein_id="CAK26946.1"
FT                   /translation="MAAALALIDCNNFYASCEQLFDPALQGRPVVVLSNNDGCIVARSR
FT                   EARQLGIAMGTPYFQVADRLRDQQVVVRSSNYALYGDMSQRVMALLKQRVPELEVYSID
FT                   EAFARLPALPAHELSSWAAELRVLVRQQLGLPIALGMAPSKVLAKLANRLAKRDPARTG
FT                   VCNLLLEPQLPDRLAEVAVEDLWGVGRRLARWCRLRGLATALDLAQADSALIRQGWGVV
FT                   GLRLQQELRGISCLALESEPAAKQETCVSRSFGTAVLDRLSLREAVAAHVVRGAEKLRR
FT                   QGQRASRLTVFVRTSPFAAGFYANSISVSLPLATADTAVLLQRALPLVDQLFRHGYAFQ
FT                   KAGVLLGQLQPQEHLQHHLLVPCSPQQLRRRSRLLQAVDGLNQRFGTGTVQWAAVGVEP
FT                   DWCMRRQHLSAHFTTSKADLPMVSAHE"
     MAAALALIDC NNFYASCEQL FDPALQGRPV VVLSNNDGCI VARSREARQL GIAMGTPYFQ        60
     VADRLRDQQV VVRSSNYALY GDMSQRVMAL LKQRVPELEV YSIDEAFARL PALPAHELSS       120
     WAAELRVLVR QQLGLPIALG MAPSKVLAKL ANRLAKRDPA RTGVCNLLLE PQLPDRLAEV       180
     AVEDLWGVGR RLARWCRLRG LATALDLAQA DSALIRQGWG VVGLRLQQEL RGISCLALES       240
     EPAAKQETCV SRSFGTAVLD RLSLREAVAA HVVRGAEKLR RQGQRASRLT VFVRTSPFAA       300
     GFYANSISVS LPLATADTAV LLQRALPLVD QLFRHGYAFQ KAGVLLGQLQ PQEHLQHHLL       360
     VPCSPQQLRR RSRLLQAVDG LNQRFGTGTV QWAAVGVEPD WCMRRQHLSA HFTTSKADLP       420
     MVSAHE                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page