(data stored in ACNUC29543 zone)

EMBL: CT978603.XSEB

CT978603.XSEB        Location/Qualifiers
FT   CDS             complement(355950..356207)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="SynRCC307_0367"
FT                   /product="Exonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27270"
FT                   /db_xref="GOA:A5GQW1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW1"
FT                   /protein_id="CAK27270.1"
FT                   /translation="MAAKAKRQADQGLKDLSYSQAQEQLEQALAQLQSDTLPLEELPQL
FT                   YAQAVALENHCRQKLEQVSQDIQKLDPDGISLSAWSEEEG"
     MAAKAKRQAD QGLKDLSYSQ AQEQLEQALA QLQSDTLPLE ELPQLYAQAV ALENHCRQKL        60
     EQVSQDIQKL DPDGISLSAW SEEEG                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page