(data stored in ACNUC29543 zone)

EMBL: CT978603.YCF3

CT978603.YCF3        Location/Qualifiers
FT   CDS             complement(250309..250830)
FT                   /transl_table=11
FT                   /gene="ycf3"
FT                   /locus_tag="SynRCC307_0252"
FT                   /product="Photosystem I assembly protein Ycf3"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27155"
FT                   /db_xref="GOA:A5GQJ6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ6"
FT                   /protein_id="CAK27155.1"
FT                   /translation="MPRSQRNDNFIDKSFTVMADLILKVLPTNQKAKEAFAYYRDGMSA
FT                   QGDGEYAEALENYQEALRLEEDPNDRAFILYNMALVYASNGEHNRALEQYEQALALNAK
FT                   MPQVLNNMAVIHHHLGSIAQEKGESDEADRRFDLAADFWSKAIRLAPNNYIEAQNWLKT
FT                   TGRGSADVYL"
     MPRSQRNDNF IDKSFTVMAD LILKVLPTNQ KAKEAFAYYR DGMSAQGDGE YAEALENYQE        60
     ALRLEEDPND RAFILYNMAL VYASNGEHNR ALEQYEQALA LNAKMPQVLN NMAVIHHHLG       120
     SIAQEKGESD EADRRFDLAA DFWSKAIRLA PNNYIEAQNW LKTTGRGSAD VYL              173
//

If you have problems or comments...

PBIL Back to PBIL home page