(data stored in SCRATCH zone)

EMBL: CU458745.PE12

CU458745.PE12        Location/Qualifiers
FT   CDS             8776..9366
FT                   /transl_table=11
FT                   /locus_tag="MAB_p11"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I415_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p11"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59638"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE4"
FT                   /protein_id="CAM59638.1"
FT                   /translation="MTSKIGPWEEAITLAADWIWERSREEDLAPLLVSNAQNAASFGYA
FT                   DLDEIIRAGGHATPQSRSRPDRGPVLTFVPDERSLHFAMGLARGYSLAVVEGSTSLAEW
FT                   AAGAAAINLLTGQVTTSQVDDDVRKDLDSVIFYGGRNGWTGADEKAQVRRFLSDHIGGG
FT                   RLTPDQAAAYALSSQSVSDRGAKRLRELLSRNR"
     MTSKIGPWEE AITLAADWIW ERSREEDLAP LLVSNAQNAA SFGYADLDEI IRAGGHATPQ        60
     SRSRPDRGPV LTFVPDERSL HFAMGLARGY SLAVVEGSTS LAEWAAGAAA INLLTGQVTT       120
     SQVDDDVRKD LDSVIFYGGR NGWTGADEKA QVRRFLSDHI GGGRLTPDQA AAYALSSQSV       180
     SDRGAKRLRE LLSRNR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page