(data stored in SCRATCH zone)

EMBL: CU458745.PE18

CU458745.PE18        Location/Qualifiers
FT   CDS             18721..19104
FT                   /transl_table=11
FT                   /locus_tag="MAB_p17"
FT                   /product="Conserved hypothetical protein"
FT                   /note="99% identical to B2I437_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p17"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59644"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF0"
FT                   /protein_id="CAM59644.1"
FT                   /translation="MIDSLELEAAIATVYAAQLPIPVWWPAEARAAFIEEYASEAACLV
FT                   LSELDAINDRMSDWTARSQVSGADESTMIASAQQVLLDEACSEVQYDLTEMIASRSAQL
FT                   MAEAVFDHSPPRAQHHVVWPVQR"
     MIDSLELEAA IATVYAAQLP IPVWWPAEAR AAFIEEYASE AACLVLSELD AINDRMSDWT        60
     ARSQVSGADE STMIASAQQV LLDEACSEVQ YDLTEMIASR SAQLMAEAVF DHSPPRAQHH       120
     VVWPVQR                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page