(data stored in SCRATCH zone)

EMBL: CU458745.PE19

CU458745.PE19        Location/Qualifiers
FT   CDS             complement(19459..19764)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p18c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="91% identical to B2I435_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p18c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59645"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF1"
FT                   /protein_id="CAM59645.1"
FT                   /translation="MHARSYSGGMDTLGTVQDDVSAVRDFASQVRALCAQLTANPFNTP
FT                   AAEKLLDLLLEDAPAVDLAFQRVLRSVIYEPASTGAPILDMLGGPRCTALVVGAAA"
     MHARSYSGGM DTLGTVQDDV SAVRDFASQV RALCAQLTAN PFNTPAAEKL LDLLLEDAPA        60
     VDLAFQRVLR SVIYEPASTG APILDMLGGP RCTALVVGAA A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page