(data stored in SCRATCH zone)

EMBL: CU458745.PE2

CU458745.PE2         Location/Qualifiers
FT   CDS             962..1402
FT                   /transl_table=11
FT                   /locus_tag="MAB_p02"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I428_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p02"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59629"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD5"
FT                   /protein_id="CAM59629.1"
FT                   /translation="MTTIKHLTALINASSLGTRTGRVARRSVTAAEGDALARRAAESGQ
FT                   GHDDSEKFRGRADERTYRPVSGSTPGRTNRKDKTMAKGHHRSATTGRYVKASTAARNPK
FT                   TTVTERGSNRSSGTHHRSAITGKFVKGSTAARHPNTTVTERG"
     MTTIKHLTAL INASSLGTRT GRVARRSVTA AEGDALARRA AESGQGHDDS EKFRGRADER        60
     TYRPVSGSTP GRTNRKDKTM AKGHHRSATT GRYVKASTAA RNPKTTVTER GSNRSSGTHH       120
     RSAITGKFVK GSTAARHPNT TVTERG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page