(data stored in SCRATCH zone)

EMBL: CU458745.PE20

CU458745.PE20        Location/Qualifiers
FT   CDS             complement(20933..21325)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p19c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I432_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p19c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59646"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF2"
FT                   /protein_id="CAM59646.1"
FT                   /translation="MNAASKPAGLQVGSTRPLSRAERRAQAARVTADETAPAAPEPQNT
FT                   DIPPAPVATPPDGEQEARQAEPVRLKARLRKVKSPFATQLHAGTLARLEWIKARGYVIT
FT                   DTVDEAINRYLDNAGIPKPDRNDRMP"
     MNAASKPAGL QVGSTRPLSR AERRAQAARV TADETAPAAP EPQNTDIPPA PVATPPDGEQ        60
     EARQAEPVRL KARLRKVKSP FATQLHAGTL ARLEWIKARG YVITDTVDEA INRYLDNAGI       120
     PKPDRNDRMP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page