(data stored in SCRATCH zone)

EMBL: CU458745.PE21

CU458745.PE21        Location/Qualifiers
FT   CDS             complement(21322..22128)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p20c"
FT                   /product="Cobyrinic acid a,c-diamine synthase or chromosome
FT                   partitioning protein ParA"
FT                   /note="97% identical to B2I431_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p20c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59647"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF3"
FT                   /protein_id="CAM59647.1"
FT                   /translation="MTVSADKQCEILAVALQKGGVGKTTTTINLGANLAAMGLRILVID
FT                   MDQQAHSTKGLGIELDAEDASMYEVLHPDRAMRVPLAKVIVPTQFGIDVAPGHLALKEL
FT                   ERTGLGSGGQLRLARQLDDIEGYDFVLLDCPPALGELTTAALAAADYVLAVLKAGPDEV
FT                   DGLVELGNSILDVQETLNPDVEIRYVLLADFDGNPKASKDVRRQLRADWGEWSDGGAYL
FT                   GEIPHTVRVVEAKGKRVPVNVHAPTSTAAVAYREVAERIAARRHAA"
     MTVSADKQCE ILAVALQKGG VGKTTTTINL GANLAAMGLR ILVIDMDQQA HSTKGLGIEL        60
     DAEDASMYEV LHPDRAMRVP LAKVIVPTQF GIDVAPGHLA LKELERTGLG SGGQLRLARQ       120
     LDDIEGYDFV LLDCPPALGE LTTAALAAAD YVLAVLKAGP DEVDGLVELG NSILDVQETL       180
     NPDVEIRYVL LADFDGNPKA SKDVRRQLRA DWGEWSDGGA YLGEIPHTVR VVEAKGKRVP       240
     VNVHAPTSTA AVAYREVAER IAARRHAA                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page