(data stored in SCRATCH zone)

EMBL: CU458745.PE22

CU458745.PE22        Location/Qualifiers
FT   CDS             complement(22250..23020)
FT                   /transl_table=11
FT                   /locus_tag="MAB_p21c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="91% identical to B2I430_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p21c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59648"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAF4"
FT                   /protein_id="CAM59648.1"
FT                   /translation="MVETPQQAEARRAAALDRAISTPRYASYLNAAGQDADRARKLYVW
FT                   DRDLSTAVLADLAIVEVALRNALHNALTSTYGPEWYQNIALDDRSMKQVERAWGYLRNP
FT                   RQGHPSTPGRVIAQCTFGMWVNLLDAGGYAGREPRRVHADYEQLWRSTLRSAFPGGRIE
FT                   ARNDPSPHASFTRTWVHSVAKTVNVLRNRVAHHEPLHNGFPLPGQRSGQQQPNRLTAAE
FT                   GVEAYMKLTRMIDRNLAEWIVNNTKVTTLLATRP"
     MVETPQQAEA RRAAALDRAI STPRYASYLN AAGQDADRAR KLYVWDRDLS TAVLADLAIV        60
     EVALRNALHN ALTSTYGPEW YQNIALDDRS MKQVERAWGY LRNPRQGHPS TPGRVIAQCT       120
     FGMWVNLLDA GGYAGREPRR VHADYEQLWR STLRSAFPGG RIEARNDPSP HASFTRTWVH       180
     SVAKTVNVLR NRVAHHEPLH NGFPLPGQRS GQQQPNRLTA AEGVEAYMKL TRMIDRNLAE       240
     WIVNNTKVTT LLATRP                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page