(data stored in ACNUC30630 zone)

EMBL: CU458896.PE11

CU458896.PE11        Location/Qualifiers
FT   CDS             complement(11717..12328)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0011c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0011c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60114"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME50"
FT                   /protein_id="CAM60114.1"
FT                   /translation="MKIFHHIALMSAVALTVVGCGGNTVSGDAITATNTARAGHDTATS
FT                   SSPTVTNTLPGPHPPPNQNSDGTTFDPCLAYSAAELSKWGLDPATVKDIGATTTLQRGC
FT                   SWQGDGWYVQQLVINRSISEYLDTNNYPDAKPVAIAGLQGSTHRLGQSGTAFCSAQIPS
FT                   QRAVVATLVSLDRPSAQKAIGDACTKAIEIATDTVPKLPK"
     MKIFHHIALM SAVALTVVGC GGNTVSGDAI TATNTARAGH DTATSSSPTV TNTLPGPHPP        60
     PNQNSDGTTF DPCLAYSAAE LSKWGLDPAT VKDIGATTTL QRGCSWQGDG WYVQQLVINR       120
     SISEYLDTNN YPDAKPVAIA GLQGSTHRLG QSGTAFCSAQ IPSQRAVVAT LVSLDRPSAQ       180
     KAIGDACTKA IEIATDTVPK LPK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page