(data stored in ACNUC30630 zone)

EMBL: CU458896.PE110

CU458896.PE110       Location/Qualifiers
FT   CDS             113915..114406
FT                   /transl_table=11
FT                   /locus_tag="MAB_0113"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25ZD7_MYCVN 3e-63"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60213"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEE9"
FT                   /protein_id="CAM60213.1"
FT                   /translation="MGAGRRVTDAVNAVLDLAPRKGEVTLTALVEAVGRDRDRSIEIIS
FT                   ADLPPGVCGQWRQYENEDIFIIQRGLPTWDRTLAHELGHVVLRHEGISVVEMARDEAEF
FT                   ASDDLIAYMLSQRTGCMGATGMEAEQEAEDFAALLLYRLGRLPSDRASIVQVRLGEAFG
FT                   "
     MGAGRRVTDA VNAVLDLAPR KGEVTLTALV EAVGRDRDRS IEIISADLPP GVCGQWRQYE        60
     NEDIFIIQRG LPTWDRTLAH ELGHVVLRHE GISVVEMARD EAEFASDDLI AYMLSQRTGC       120
     MGATGMEAEQ EAEDFAALLL YRLGRLPSDR ASIVQVRLGE AFG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page