(data stored in ACNUC30630 zone)

EMBL: CU458896.PE112

CU458896.PE112       Location/Qualifiers
FT   CDS             complement(115623..116021)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0115c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q9CDC9_MYCLE 1e-57"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0115c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60215"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEF1"
FT                   /protein_id="CAM60215.1"
FT                   /translation="MSTTFTARLNRLFDTVYPPGRGPHTSAEVIAALRSEGITMSAPYL
FT                   SQLRSGNRTNPSSATMKALANFFRIKPAYFTDDEYYEKLDQELTWLANMRDEGVRRIAA
FT                   RTVGLSVEAQDRITQTVDEYRRKEGLDS"
     MSTTFTARLN RLFDTVYPPG RGPHTSAEVI AALRSEGITM SAPYLSQLRS GNRTNPSSAT        60
     MKALANFFRI KPAYFTDDEY YEKLDQELTW LANMRDEGVR RIAARTVGLS VEAQDRITQT       120
     VDEYRRKEGL DS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page