(data stored in ACNUC30630 zone)

EMBL: CU458896.PE132

CU458896.PE132       Location/Qualifiers
FT   CDS             133293..133502
FT                   /transl_table=11
FT                   /locus_tag="MAB_0135"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60235"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEH1"
FT                   /protein_id="CAM60235.1"
FT                   /translation="MPRATIAEAKYQAPHHCRGSAGEAQGLMDQDASLVRGVCAERAAV
FT                   AIPHLAGLGPGGRTCSRLNCRYRI"
     MPRATIAEAK YQAPHHCRGS AGEAQGLMDQ DASLVRGVCA ERAAVAIPHL AGLGPGGRTC        60
     SRLNCRYRI                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page