(data stored in ACNUC30630 zone)

EMBL: CU458896.PE146

CU458896.PE146       Location/Qualifiers
FT   CDS             complement(146195..146566)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0149c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0149c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60249"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEI5"
FT                   /protein_id="CAM60249.1"
FT                   /translation="MADVPAPAQREEIRWDLANQPGTVLQVDPDVMKDAAVEYDAMAQR
FT                   LQEALDKQLETAKFGSAGRDEVSTAVSHASAKTNENFEKVAKDGIEQLKRIAEAFRRNS
FT                   QAFVDLEHHNAARINGVGE"
     MADVPAPAQR EEIRWDLANQ PGTVLQVDPD VMKDAAVEYD AMAQRLQEAL DKQLETAKFG        60
     SAGRDEVSTA VSHASAKTNE NFEKVAKDGI EQLKRIAEAF RRNSQAFVDL EHHNAARING       120
     VGE                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page