(data stored in ACNUC30630 zone)

EMBL: CU458896.PE153

CU458896.PE153       Location/Qualifiers
FT   CDS             complement(151934..153487)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0156c"
FT                   /product="Iron-sulfur cluster-binding protein, RIESKE
FT                   family"
FT                   /note="Similar to O07805_MYCTU 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0156c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60256"
FT                   /db_xref="GOA:B1MEJ2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEJ2"
FT                   /protein_id="CAM60256.1"
FT                   /translation="MRVTSVGHAGFFIETAAGSILCDPWVNPAYFASWFPFPDNSTLDW
FT                   DRFGSCDYLYVSHLHKDHYDPKNLTDHVNKDAVVLLPDYPVPDLRRELEGLGFHTFVET
FT                   EDSVKHRVSGPKGDLDIMIIALRAPADGPIGDSGLVVSDGTTTAFNMNDARPVDLDVLA
FT                   EEFGHIDVHMLQYSGAIWYPMVYDMPARAKEAFGTQKRQRQMDRCRQYIAQVGATWVIP
FT                   SAGPPCFLDTGLRDLNDDHDDPANIFPDQLVFLDQMRQHGHDKGLLMIPGTVADFTASE
FT                   LNSLEHPVSTEEAEDIFGAGKAAYIEAYAQRMAPVLAAEKSSWAPAEGEPLLAPLRAKF
FT                   EPIMAQTDQICDGIGYPVELRLGSETVVLDFPKRIVREPIPNEKYRYGFEIAPELVRTV
FT                   LRDDEPDWVNTIFLSTRFKAWRVGGYNEYLYTFFKCLTDERIAYADGWFAEAHDDSASI
FT                   TLDGWEIQRRCPHLKADLSKFGVVEGKNLTCNLHGWEWNLENGRCLTSKGHELRSRKLG
FT                   "
     MRVTSVGHAG FFIETAAGSI LCDPWVNPAY FASWFPFPDN STLDWDRFGS CDYLYVSHLH        60
     KDHYDPKNLT DHVNKDAVVL LPDYPVPDLR RELEGLGFHT FVETEDSVKH RVSGPKGDLD       120
     IMIIALRAPA DGPIGDSGLV VSDGTTTAFN MNDARPVDLD VLAEEFGHID VHMLQYSGAI       180
     WYPMVYDMPA RAKEAFGTQK RQRQMDRCRQ YIAQVGATWV IPSAGPPCFL DTGLRDLNDD       240
     HDDPANIFPD QLVFLDQMRQ HGHDKGLLMI PGTVADFTAS ELNSLEHPVS TEEAEDIFGA       300
     GKAAYIEAYA QRMAPVLAAE KSSWAPAEGE PLLAPLRAKF EPIMAQTDQI CDGIGYPVEL       360
     RLGSETVVLD FPKRIVREPI PNEKYRYGFE IAPELVRTVL RDDEPDWVNT IFLSTRFKAW       420
     RVGGYNEYLY TFFKCLTDER IAYADGWFAE AHDDSASITL DGWEIQRRCP HLKADLSKFG       480
     VVEGKNLTCN LHGWEWNLEN GRCLTSKGHE LRSRKLG                                517
//

If you have problems or comments...

PBIL Back to PBIL home page