(data stored in ACNUC30630 zone)

EMBL: CU458896.PE17

CU458896.PE17        Location/Qualifiers
FT   CDS             16690..17262
FT                   /transl_table=11
FT                   /locus_tag="MAB_0017"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q82R37_STRAW 2e-51"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60120"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME56"
FT                   /protein_id="CAM60120.1"
FT                   /translation="MAADRPTIYFASQRDWEAWLEQNHEDSPGVWIKMAKKASGIASLN
FT                   HKEALEEALCFGWIDGQARSLDEQYTLRMFTPRRPRSTWSKINVGHIERLATEGRIRPA
FT                   GQREVDAAKADGRWDAAYSSQATIEVPGDFARALESEPGALAFFDSLNKTARWPFLFRL
FT                   TTIKKPETRARRIAQYVELLAEGKTLH"
     MAADRPTIYF ASQRDWEAWL EQNHEDSPGV WIKMAKKASG IASLNHKEAL EEALCFGWID        60
     GQARSLDEQY TLRMFTPRRP RSTWSKINVG HIERLATEGR IRPAGQREVD AAKADGRWDA       120
     AYSSQATIEV PGDFARALES EPGALAFFDS LNKTARWPFL FRLTTIKKPE TRARRIAQYV       180
     ELLAEGKTLH                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page