(data stored in ACNUC30630 zone)

EMBL: CU458896.PE173

CU458896.PE173       Location/Qualifiers
FT   CDS             172726..173727
FT                   /transl_table=11
FT                   /locus_tag="MAB_0176"
FT                   /product="Antigen 85-A precursor"
FT                   /note="Similar to A85A_MYCTU e-111"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60276"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEL2"
FT                   /protein_id="CAM60276.1"
FT                   /translation="MKLFSKMRGALARQSARRIAVAATAVAVLPGVAGIVGGTALTPVA
FT                   GAFSRPGLPVEYLQVPSASMGREIKVQFQPGGAKAVYLLDGLRARDDFSGWDIETTAFE
FT                   DYYQSGISMVMPVGGQSSFYTDWYNPAKGKDGVWTYKWETFTTQELPAYLAANKGISQT
FT                   GNAVVGLSMGASAALTLSIYHPQLFVYAGALSGFLNPSDMKFQIGLAMGDAGGFSASDM
FT                   WGPDSDPAWQRNDPFLNIQKIIDNGTRLWIYCGTGDSTDLDATRNGFENFTGGFLEGMA
FT                   IGSNKKFVEAYTAAGGKNAHIEFPPGGIHNWTYWGQQLRAMKPDMVAYLQSH"
     MKLFSKMRGA LARQSARRIA VAATAVAVLP GVAGIVGGTA LTPVAGAFSR PGLPVEYLQV        60
     PSASMGREIK VQFQPGGAKA VYLLDGLRAR DDFSGWDIET TAFEDYYQSG ISMVMPVGGQ       120
     SSFYTDWYNP AKGKDGVWTY KWETFTTQEL PAYLAANKGI SQTGNAVVGL SMGASAALTL       180
     SIYHPQLFVY AGALSGFLNP SDMKFQIGLA MGDAGGFSAS DMWGPDSDPA WQRNDPFLNI       240
     QKIIDNGTRL WIYCGTGDST DLDATRNGFE NFTGGFLEGM AIGSNKKFVE AYTAAGGKNA       300
     HIEFPPGGIH NWTYWGQQLR AMKPDMVAYL QSH                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page