(data stored in ACNUC30630 zone)

EMBL: CU458896.PE184

CU458896.PE184       Location/Qualifiers
FT   CDS             193996..195162
FT                   /transl_table=11
FT                   /locus_tag="MAB_0187"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YMZ2_NOCFA 7e-32"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60287"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEM3"
FT                   /protein_id="CAM60287.1"
FT                   /translation="MQPSPYTPGQVAREVVGRAEQLAEIGERLMYMTELGRLIGRIRVD
FT                   TGPRGVGKTSLLREVQRAAEARGVVTVWVTAGGEEPLTAAIATQIRARTAGWKKKSRGR
FT                   LLRAIDQVSITAGVPGVAQLGATVKPAQSAEGASPEPSFKELIVETVKAARDEGHRGLV
FT                   LLIDEVQDADRQGLRTLAVTWQDLQAEADALPAGLFAAGLPQTPEIISAAATFSERFAY
FT                   RTLHRLGPDASRVALVKPAGQVGVDWAPDALEAVIAQTNGYPHTLQLYADAAWARAGYP
FT                   DPGGQIGMPDVEHAARQVAEDMDALFRARWNNATPVQRRFMTAMAQSLTDDRVSSRSDI
FT                   AAALGRDSRAISAARAGLIDKGLIAVAGHGLLEFSIPGFAEFVHAQEG"
     MQPSPYTPGQ VAREVVGRAE QLAEIGERLM YMTELGRLIG RIRVDTGPRG VGKTSLLREV        60
     QRAAEARGVV TVWVTAGGEE PLTAAIATQI RARTAGWKKK SRGRLLRAID QVSITAGVPG       120
     VAQLGATVKP AQSAEGASPE PSFKELIVET VKAARDEGHR GLVLLIDEVQ DADRQGLRTL       180
     AVTWQDLQAE ADALPAGLFA AGLPQTPEII SAAATFSERF AYRTLHRLGP DASRVALVKP       240
     AGQVGVDWAP DALEAVIAQT NGYPHTLQLY ADAAWARAGY PDPGGQIGMP DVEHAARQVA       300
     EDMDALFRAR WNNATPVQRR FMTAMAQSLT DDRVSSRSDI AAALGRDSRA ISAARAGLID       360
     KGLIAVAGHG LLEFSIPGFA EFVHAQEG                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page