(data stored in ACNUC30630 zone)

EMBL: CU458896.PE195

CU458896.PE195       Location/Qualifiers
FT   CDS             208241..208870
FT                   /transl_table=11
FT                   /locus_tag="MAB_0198"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q47M55_THEFY 4e-09"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60298"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEN4"
FT                   /protein_id="CAM60298.1"
FT                   /translation="MILARWRAKDGEKRPATPLSRVAGLTVSLVAGAAVMGIVSEVEKP
FT                   QVQLSIKPPQNAIAFIAELPRAQRDRRYISGEALAMEARARAIKPCSTVLAGARPAVAQ
FT                   AGNFLKGMFGIGDIGGANGRGGGGDHGRGLALDFMTSSYSTGTALANFVLANRDRLGVT
FT                   YVIWQQRYNDGNGWSMMENRGSPTANHMDHVHVSFRADAKPPAVNC"
     MILARWRAKD GEKRPATPLS RVAGLTVSLV AGAAVMGIVS EVEKPQVQLS IKPPQNAIAF        60
     IAELPRAQRD RRYISGEALA MEARARAIKP CSTVLAGARP AVAQAGNFLK GMFGIGDIGG       120
     ANGRGGGGDH GRGLALDFMT SSYSTGTALA NFVLANRDRL GVTYVIWQQR YNDGNGWSMM       180
     ENRGSPTANH MDHVHVSFRA DAKPPAVNC                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page