(data stored in ACNUC30630 zone)

EMBL: CU458896.PE197

CU458896.PE197       Location/Qualifiers
FT   CDS             complement(210360..211040)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0200c"
FT                   /product="Probable phosphoesterase, PA-phosphatase related
FT                   protein"
FT                   /note="Similar to Q27C97_MYCFV 2e-50"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0200c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60300"
FT                   /db_xref="GOA:B1MEN6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEN6"
FT                   /protein_id="CAM60300.1"
FT                   /translation="MPARSDRGYVWPLLSAAAALIVFALLWLGYAQQWNGLSRLDVGAL
FT                   TPAHHYGIAHPGWVTVWDVFATALGPGAFRIGGAIIIIVLLVRGQRRPAVFLLVTIELS
FT                   ALVTELAKLLAGRPRPATKLVDAYGTSFPSGHALGIMVCVLALLTVFTPKVVAAWRPWL
FT                   GVLGGVLILLIGISRVLLNVHNPSDVLAGWALGYAYFIVCLLALPPWTVTAADGTPPAP
FT                   GNAP"
     MPARSDRGYV WPLLSAAAAL IVFALLWLGY AQQWNGLSRL DVGALTPAHH YGIAHPGWVT        60
     VWDVFATALG PGAFRIGGAI IIIVLLVRGQ RRPAVFLLVT IELSALVTEL AKLLAGRPRP       120
     ATKLVDAYGT SFPSGHALGI MVCVLALLTV FTPKVVAAWR PWLGVLGGVL ILLIGISRVL       180
     LNVHNPSDVL AGWALGYAYF IVCLLALPPW TVTAADGTPP APGNAP                      226
//

If you have problems or comments...

PBIL Back to PBIL home page