(data stored in ACNUC30630 zone)

EMBL: CU458896.PE198

CU458896.PE198       Location/Qualifiers
FT   CDS             complement(211043..211930)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0201c"
FT                   /product="Probable O-antigen/lipopolysaccharide transport
FT                   integral membrane protein ABC transporter RfbD"
FT                   /note="Similar to Q25Z80_MYCVN e-114"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0201c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60301"
FT                   /db_xref="GOA:B1MEN7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEN7"
FT                   /protein_id="CAM60301.1"
FT                   /translation="MSSSAGLTSQRPGSKENDMANELIELSSDSRTFKRAWRDLSEGFE
FT                   HRQLWLQLGWQDIKQRYRRSVLGPFWITIATGSTALAMGILYSQLFKLPLAEHLPYVTI
FT                   GLIVWNLFNAAILEGSDVFVANEGLIKQLPTPLSVHVYRLVWRQLLLFAHNIIIFLIVV
FT                   AVYTPHWHFTDLSFIPALVLITLNCLWVSLVFGVLATRYRDISPLLGSLVQLLFFMTPI
FT                   IWNENMLNQRVGKLATVVQLNPFVHFLAIIRDPLLGLDQQLHHWIIALSITVVGWIVAI
FT                   VVMRQYRARVPYWV"
     MSSSAGLTSQ RPGSKENDMA NELIELSSDS RTFKRAWRDL SEGFEHRQLW LQLGWQDIKQ        60
     RYRRSVLGPF WITIATGSTA LAMGILYSQL FKLPLAEHLP YVTIGLIVWN LFNAAILEGS       120
     DVFVANEGLI KQLPTPLSVH VYRLVWRQLL LFAHNIIIFL IVVAVYTPHW HFTDLSFIPA       180
     LVLITLNCLW VSLVFGVLAT RYRDISPLLG SLVQLLFFMT PIIWNENMLN QRVGKLATVV       240
     QLNPFVHFLA IIRDPLLGLD QQLHHWIIAL SITVVGWIVA IVVMRQYRAR VPYWV            295
//

If you have problems or comments...

PBIL Back to PBIL home page