(data stored in ACNUC30630 zone)

EMBL: CU458896.PE201

CU458896.PE201       Location/Qualifiers
FT   CDS             complement(213610..214128)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0204c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Y3780_MYCTU 8e-40"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0204c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60304"
FT                   /db_xref="GOA:B1MEP0"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEP0"
FT                   /protein_id="CAM60304.1"
FT                   /translation="MTNPGHDEDDDQVIILGADDSDKGADGLDDDLSVTDLVEQPAKVM
FT                   RIGTMIKQLLEEVRAAPLDDASRSRLREIHATSIRELEEGLAPELREELERLALPFNED
FT                   TIPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLQQMRKGALPPGLSVPAQG
FT                   GGSGTGQYL"
     MTNPGHDEDD DQVIILGADD SDKGADGLDD DLSVTDLVEQ PAKVMRIGTM IKQLLEEVRA        60
     APLDDASRSR LREIHATSIR ELEEGLAPEL REELERLALP FNEDTIPSDA ELRIAQAQLV       120
     GWLEGLFHGI QTALFAQQMA ARAQLQQMRK GALPPGLSVP AQGGGSGTGQ YL               172
//

If you have problems or comments...

PBIL Back to PBIL home page