(data stored in ACNUC30630 zone)

EMBL: CU458896.PE209

CU458896.PE209       Location/Qualifiers
FT   CDS             224223..224687
FT                   /transl_table=11
FT                   /locus_tag="MAB_0212"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q8YMP7_ANASP 6e-06"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60312"
FT                   /db_xref="GOA:B1MEP8"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEP8"
FT                   /protein_id="CAM60312.1"
FT                   /translation="MQLFSQMIARPERLVCAIAVTVGLVFASIGGATALYESKFQQRSA
FT                   IVNGRVVDQQPRRSCNSSDDCHTSMYPVVQFDVDGQRITFASDTTGLLSPRTGETVPVR
FT                   YDPANPYDAEISSFESEWGLSLIFGLIGLALVGVGVVVLVQARQTSTYNE"
     MQLFSQMIAR PERLVCAIAV TVGLVFASIG GATALYESKF QQRSAIVNGR VVDQQPRRSC        60
     NSSDDCHTSM YPVVQFDVDG QRITFASDTT GLLSPRTGET VPVRYDPANP YDAEISSFES       120
     EWGLSLIFGL IGLALVGVGV VVLVQARQTS TYNE                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page