(data stored in ACNUC30630 zone)

EMBL: CU458896.PE213

CU458896.PE213       Location/Qualifiers
FT   CDS             227341..227661
FT                   /transl_table=11
FT                   /locus_tag="MAB_0216"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q73WD7_MYCPA 1e-20"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60316"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEQ2"
FT                   /protein_id="CAM60316.1"
FT                   /translation="MTALANAQAATARNAPSGRAAHTVHGGSGHALRQVIMALAARHKL
FT                   AEHENPGEATLLVLSGLVELATSTARATLAAGEYVVFPQERHELTAIEDSVVLLTVVSR
FT                   AG"
     MTALANAQAA TARNAPSGRA AHTVHGGSGH ALRQVIMALA ARHKLAEHEN PGEATLLVLS        60
     GLVELATSTA RATLAAGEYV VFPQERHELT AIEDSVVLLT VVSRAG                      106
//

If you have problems or comments...

PBIL Back to PBIL home page