(data stored in ACNUC30630 zone)

EMBL: CU458896.PE223

CU458896.PE223       Location/Qualifiers
FT   CDS             236137..236853
FT                   /transl_table=11
FT                   /locus_tag="MAB_0226"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60326"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFC6"
FT                   /protein_id="CAM60326.1"
FT                   /translation="MSVSTGYDERQALCCECGNLRSCRRPKNYREENFWLNRPVDRSWH
FT                   RETGDLKCEHCARTTRHALLYREGDGFKDHAERLERIALGGSDPLDAESSGVTEQIKKN
FT                   YRIGRQTNPHLRHSWWTGDADQARALGTSTVVTLCGDKYEIPDNPVAYDDDEDEIGPAQ
FT                   TRAAQYHRQIFSDDSPPEGWDYQDCPDCTRVVNEWVIERNRNYLMAKLTKLMRTAFDLN
FT                   APALERLIAVVEQAEL"
     MSVSTGYDER QALCCECGNL RSCRRPKNYR EENFWLNRPV DRSWHRETGD LKCEHCARTT        60
     RHALLYREGD GFKDHAERLE RIALGGSDPL DAESSGVTEQ IKKNYRIGRQ TNPHLRHSWW       120
     TGDADQARAL GTSTVVTLCG DKYEIPDNPV AYDDDEDEIG PAQTRAAQYH RQIFSDDSPP       180
     EGWDYQDCPD CTRVVNEWVI ERNRNYLMAK LTKLMRTAFD LNAPALERLI AVVEQAEL         238
//

If you have problems or comments...

PBIL Back to PBIL home page