(data stored in ACNUC30630 zone)

EMBL: CU458896.PE239

CU458896.PE239       Location/Qualifiers
FT   CDS             247688..247981
FT                   /transl_table=11
FT                   /locus_tag="MAB_0242"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60342"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFE2"
FT                   /protein_id="CAM60342.1"
FT                   /translation="MDGRSDSGGVIRVRPEELHHSAAMLHEIAQDLKTAHGQAHGQLTD
FT                   LLSEFGEGPARSMLAEHLSTWEEETRSHHEHLTGQAEFHTTMAHKFVEIDKL"
     MDGRSDSGGV IRVRPEELHH SAAMLHEIAQ DLKTAHGQAH GQLTDLLSEF GEGPARSMLA        60
     EHLSTWEEET RSHHEHLTGQ AEFHTTMAHK FVEIDKL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page