(data stored in ACNUC30630 zone)

EMBL: CU458896.PE242

CU458896.PE242       Location/Qualifiers
FT   CDS             complement(249595..249819)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0245c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0245c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60345"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFE5"
FT                   /protein_id="CAM60345.1"
FT                   /translation="MAPLLTLGMFLFFGLMMYVAYRQRKQPRRRLWRNPYMPSPYLWRG
FT                   APDWPDTPRPPWPVDDDGNPIDVDEAAER"
     MAPLLTLGMF LFFGLMMYVA YRQRKQPRRR LWRNPYMPSP YLWRGAPDWP DTPRPPWPVD        60
     DDGNPIDVDE AAER                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page