(data stored in ACNUC30630 zone)

EMBL: CU458896.PE245

CU458896.PE245       Location/Qualifiers
FT   CDS             complement(251072..251665)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0248c"
FT                   /product="Putative regulatory protein, TetR family"
FT                   /note="Similar to Q2JF42_FRASC 2e-09"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0248c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60348"
FT                   /db_xref="GOA:B1MFE8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFE8"
FT                   /protein_id="CAM60348.1"
FT                   /translation="MRPASGLREQKKSETKLALSRAALELALDRGDLAAVTVDDIADAV
FT                   RVSARTFRNYFTSKEDAVLFSLRGIEDNAVALLRQRPQHEHVVDSLEAVMLDLATSEAF
FT                   STTVAVTRLSAQNPGLAAHDAARSEDVGTVVLTEVSRRAGLDPDVDLYPRLVCNAAYAV
FT                   LATVIQLAVSGSKLSKDPGALVAQGFQRLRDGLA"
     MRPASGLREQ KKSETKLALS RAALELALDR GDLAAVTVDD IADAVRVSAR TFRNYFTSKE        60
     DAVLFSLRGI EDNAVALLRQ RPQHEHVVDS LEAVMLDLAT SEAFSTTVAV TRLSAQNPGL       120
     AAHDAARSED VGTVVLTEVS RRAGLDPDVD LYPRLVCNAA YAVLATVIQL AVSGSKLSKD       180
     PGALVAQGFQ RLRDGLA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page