(data stored in ACNUC30630 zone)

EMBL: CU458896.PE250

CU458896.PE250       Location/Qualifiers
FT   CDS             255920..256432
FT                   /transl_table=11
FT                   /locus_tag="MAB_0253"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60353"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFF3"
FT                   /protein_id="CAM60353.1"
FT                   /translation="MKPLTTIVTMLVLAAATACQGPGTGPAKTTSEDTMQPITLTVTEA
FT                   ARITAGYVSLVSGQEVDPSPDGVEKVGCRTNKESLMSEGPPWKVRRQWWVDHPPRELIS
FT                   GAMGRLESLAAQGFERQPWTRPDPEPLDTKTYHDARGYVVGARAYTTAGGRELFEVTVM
FT                   SPCANEG"
     MKPLTTIVTM LVLAAATACQ GPGTGPAKTT SEDTMQPITL TVTEAARITA GYVSLVSGQE        60
     VDPSPDGVEK VGCRTNKESL MSEGPPWKVR RQWWVDHPPR ELISGAMGRL ESLAAQGFER       120
     QPWTRPDPEP LDTKTYHDAR GYVVGARAYT TAGGRELFEV TVMSPCANEG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page