(data stored in ACNUC30630 zone)

EMBL: CU458896.PE264

CU458896.PE264       Location/Qualifiers
FT   CDS             268164..268694
FT                   /transl_table=11
FT                   /locus_tag="MAB_0267"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5Z3B2_NOCFA 2e-47"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60367"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFG7"
FT                   /protein_id="CAM60367.1"
FT                   /translation="MDAQRAKAAGPSAESLEGFGVAVVREEGRWRVTSLKARALTDLAA
FT                   AETELRELRSAGAVFGLLDVDEEFFIIIRPAPSGTHLLISDATAAIDYDIAVEVLERLN
FT                   IPVPELELDELDEVDPWEEGDLGLLSDIGLPEPVLSVILSETDLYPDEQLGMIAARMGF
FT                   ADEFGAVLDKLDR"
     MDAQRAKAAG PSAESLEGFG VAVVREEGRW RVTSLKARAL TDLAAAETEL RELRSAGAVF        60
     GLLDVDEEFF IIIRPAPSGT HLLISDATAA IDYDIAVEVL ERLNIPVPEL ELDELDEVDP       120
     WEEGDLGLLS DIGLPEPVLS VILSETDLYP DEQLGMIAAR MGFADEFGAV LDKLDR           176
//

If you have problems or comments...

PBIL Back to PBIL home page