(data stored in ACNUC30630 zone)

EMBL: CU458896.PE279

CU458896.PE279       Location/Qualifiers
FT   CDS             281608..282114
FT                   /transl_table=11
FT                   /locus_tag="MAB_0282"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q266E8_MYCVN 6e-07"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60382"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFI2"
FT                   /protein_id="CAM60382.1"
FT                   /translation="MRRWAATCAVALFTVSGCSVWDKAESTPTSYTPQQTGASPVRYDS
FT                   DPLEQRFPKLPKPVTGEWVQGFFSDEPLPGPNTTYWMDAIIEMPPQQLAAYVAPFRASM
FT                   VLASRPRLWKTLDTGVPAAAQFERSDELDRMLSTNTDKGGWQVKAFAPKDGSVLILSAR
FT                   GKDAG"
     MRRWAATCAV ALFTVSGCSV WDKAESTPTS YTPQQTGASP VRYDSDPLEQ RFPKLPKPVT        60
     GEWVQGFFSD EPLPGPNTTY WMDAIIEMPP QQLAAYVAPF RASMVLASRP RLWKTLDTGV       120
     PAAAQFERSD ELDRMLSTNT DKGGWQVKAF APKDGSVLIL SARGKDAG                    168
//

If you have problems or comments...

PBIL Back to PBIL home page