(data stored in ACNUC30630 zone)

EMBL: CU458896.PE28

CU458896.PE28        Location/Qualifiers
FT   CDS             complement(28004..28267)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0029c"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to Q744R9_MYCPA 5e-32"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0029c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60131"
FT                   /db_xref="GOA:B1ME67"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME67"
FT                   /protein_id="CAM60131.1"
FT                   /translation="MPKSKVRKKSAFNATTVSRTPVKVKAGPSSVWFVAFFLTLMLIGL
FT                   AWLMVFQLAAQHITWMLDLGPWNYAIAFAFMITGLLLTMRWR"
     MPKSKVRKKS AFNATTVSRT PVKVKAGPSS VWFVAFFLTL MLIGLAWLMV FQLAAQHITW        60
     MLDLGPWNYA IAFAFMITGL LLTMRWR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page