(data stored in ACNUC30630 zone)

EMBL: CU458896.PE286

CU458896.PE286       Location/Qualifiers
FT   CDS             288553..290481
FT                   /transl_table=11
FT                   /locus_tag="MAB_0289"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q2L6D4_9ACTO 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60389"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFI9"
FT                   /protein_id="CAM60389.1"
FT                   /translation="MSDHQICIIGAGPRGLAVLERLCANERHAPSADRIVVHVVDPYSP
FT                   GAGSVWRTDQSWHLLMNTVASQITVFTDDSVAIDGPIEPGPTLYEWAQSLALLGDPSHS
FT                   GPRAIEEARTLRPNSYPTRALYGHYLSDSFARVVGWAPEHVTVRVHRSRAVALADTRGD
FT                   IEGPQGVRLENGTRLHDLKAVVLAVGHVPAGLRPSEARAASLARIHGLTYVTPANPADI
FT                   DLSAIKPGEPVAVRGLGLNFFDYMALLTVGRGGRFVRAGARLVYQPSGQEPVLYASSRR
FT                   GIPYHARGENQKGSAGRYFPRLLTVERINRMREDLGALLQFRRDLWPLIAREVECVYYE
FT                   RHLAQRGVSVEEFAECYLNAAPEELPSILSEHGLVDIAWKWDDLDRPWGDRRFTGPDDF
FT                   TAWILAHLRADVVMAREGNVDGPVKAALDVLRDLRNEIRLAVDHGGLDGKSYRDELESW
FT                   YTPLNAFLSIGPPAQRIEEIIALVEAGVMHLVGPQMQVRFDTQDPAVVVESPLVPGSAV
FT                   RTRSLIEARLHEPDLRRSNDPLLIFLQETGQCRQYEIPTGDNKTYQTRGLAVTARPYRL
FT                   IGADGRAHPRRFAYGVPTESVHWVTAAGIRPGVDSVTLGDADAIARAALASAPTAAADV
FT                   GDHGVLV"
     MSDHQICIIG AGPRGLAVLE RLCANERHAP SADRIVVHVV DPYSPGAGSV WRTDQSWHLL        60
     MNTVASQITV FTDDSVAIDG PIEPGPTLYE WAQSLALLGD PSHSGPRAIE EARTLRPNSY       120
     PTRALYGHYL SDSFARVVGW APEHVTVRVH RSRAVALADT RGDIEGPQGV RLENGTRLHD       180
     LKAVVLAVGH VPAGLRPSEA RAASLARIHG LTYVTPANPA DIDLSAIKPG EPVAVRGLGL       240
     NFFDYMALLT VGRGGRFVRA GARLVYQPSG QEPVLYASSR RGIPYHARGE NQKGSAGRYF       300
     PRLLTVERIN RMREDLGALL QFRRDLWPLI AREVECVYYE RHLAQRGVSV EEFAECYLNA       360
     APEELPSILS EHGLVDIAWK WDDLDRPWGD RRFTGPDDFT AWILAHLRAD VVMAREGNVD       420
     GPVKAALDVL RDLRNEIRLA VDHGGLDGKS YRDELESWYT PLNAFLSIGP PAQRIEEIIA       480
     LVEAGVMHLV GPQMQVRFDT QDPAVVVESP LVPGSAVRTR SLIEARLHEP DLRRSNDPLL       540
     IFLQETGQCR QYEIPTGDNK TYQTRGLAVT ARPYRLIGAD GRAHPRRFAY GVPTESVHWV       600
     TAAGIRPGVD SVTLGDADAI ARAALASAPT AAADVGDHGV LV                          642
//

If you have problems or comments...

PBIL Back to PBIL home page