(data stored in ACNUC30630 zone)

EMBL: CU458896.PE291

CU458896.PE291       Location/Qualifiers
FT   CDS             296978..298159
FT                   /transl_table=11
FT                   /locus_tag="MAB_0295"
FT                   /product="Putative phenazine biosynthesis protein PhzC"
FT                   /note="Similar to Q7DC82_PSEAE e-114"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60394"
FT                   /db_xref="GOA:B1MFJ4"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFJ4"
FT                   /protein_id="CAM60394.1"
FT                   /translation="MEITGMTAPSLLLDTGRAVQQPVWENHVHLERVRSELSELPALVG
FT                   ADEIRTLRTLLSTVAQGRATIIQAGDCAEDPQESTPVHVARKVALLNILAGAMRMKTHR
FT                   PVLRVGRIGGQYAKPRSKPTEMVGGVELASFRGHLVNGPQPHPVHRRANPDRMLAGYWA
FT                   ANRVMGHLGWRVPSSLSVIEPPVWTSHEALLLDYEVPQLRRDGENRMVLTSTHWPWIGD
FT                   RTRHLDGPHVELFSRIANPVACKVGPSMTTEDLLALCEKLDPQRESGRLTLIARLGAAA
FT                   VRSTLPELVAAVRDSGHPVIWLCDPLHANTVSTDSGYKTRHVQTAIDEVRGFRAALEEA
FT                   GVHAGGLHLEATPDDVVECVFDSSQNDEVGQRYSTLCDPRLNTAQATEVVSAW"
     MEITGMTAPS LLLDTGRAVQ QPVWENHVHL ERVRSELSEL PALVGADEIR TLRTLLSTVA        60
     QGRATIIQAG DCAEDPQEST PVHVARKVAL LNILAGAMRM KTHRPVLRVG RIGGQYAKPR       120
     SKPTEMVGGV ELASFRGHLV NGPQPHPVHR RANPDRMLAG YWAANRVMGH LGWRVPSSLS       180
     VIEPPVWTSH EALLLDYEVP QLRRDGENRM VLTSTHWPWI GDRTRHLDGP HVELFSRIAN       240
     PVACKVGPSM TTEDLLALCE KLDPQRESGR LTLIARLGAA AVRSTLPELV AAVRDSGHPV       300
     IWLCDPLHAN TVSTDSGYKT RHVQTAIDEV RGFRAALEEA GVHAGGLHLE ATPDDVVECV       360
     FDSSQNDEVG QRYSTLCDPR LNTAQATEVV SAW                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page