(data stored in ACNUC30630 zone)

EMBL: CU458896.PE294

CU458896.PE294       Location/Qualifiers
FT   CDS             299547..301403
FT                   /transl_table=11
FT                   /locus_tag="MAB_0298"
FT                   /product="Putative phenazine biosynthesis protein PhzE"
FT                   /note="Similar to Q7DC81_PSEAE 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60397"
FT                   /db_xref="GOA:B1MFJ7"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFJ7"
FT                   /protein_id="CAM60397.1"
FT                   /translation="MSDLLGRVLAGGAGPFALLYRPESGAPDTVDVVSGAVTAVERIAD
FT                   LPLRDAHPGHDLLALVPYRQIVERGFVAPDDGAPLLALVIEEQESAALSDVLDRISEHP
FT                   VVVGHSDFDIDDEEYARLASGIISEEIGQGAGANFVLKRNLLVQLHDYSIDTALTLFRR
FT                   LLERERGAYWTFLVSTGNQVFIGATPERHISVQDSLAVMNPISGTYRYDANGPSLDAVM
FT                   EFLADTKESDELYMVVDEELKMMARICPEGGQVQGPYLKEMARLAHTEYLISGVTDRDP
FT                   REILAETMFAPTVTGSPLENACRVIQRYEPKGRRYYSGVAALISADSAGVRQLDSAILI
FT                   RTAEISADGALTAGTGATIVRHSNPASEAAETRSKAAGLLSALTTRRELRSHPRVTEAL
FT                   ASRNTGIGSFWLGHGSGESAANLAGRTALVIDAEDTFTSMIGLQLRALGLRVDIRRFDE
FT                   EIHPGSHDFLVLGPGPGDPTAIDMPKIAALTALTKAALTQRVPFLSICLSHQVLCRQLG
FT                   LPIRRKEQPNQGVQRQIDLFGTERHVGFYNTFAAVTGSEWLDTPAGRVQISSDAVTGEV
FT                   HALRAKRFASIQFHAESILTRDGVGIFAELLTPLATGVPVLA"
     MSDLLGRVLA GGAGPFALLY RPESGAPDTV DVVSGAVTAV ERIADLPLRD AHPGHDLLAL        60
     VPYRQIVERG FVAPDDGAPL LALVIEEQES AALSDVLDRI SEHPVVVGHS DFDIDDEEYA       120
     RLASGIISEE IGQGAGANFV LKRNLLVQLH DYSIDTALTL FRRLLERERG AYWTFLVSTG       180
     NQVFIGATPE RHISVQDSLA VMNPISGTYR YDANGPSLDA VMEFLADTKE SDELYMVVDE       240
     ELKMMARICP EGGQVQGPYL KEMARLAHTE YLISGVTDRD PREILAETMF APTVTGSPLE       300
     NACRVIQRYE PKGRRYYSGV AALISADSAG VRQLDSAILI RTAEISADGA LTAGTGATIV       360
     RHSNPASEAA ETRSKAAGLL SALTTRRELR SHPRVTEALA SRNTGIGSFW LGHGSGESAA       420
     NLAGRTALVI DAEDTFTSMI GLQLRALGLR VDIRRFDEEI HPGSHDFLVL GPGPGDPTAI       480
     DMPKIAALTA LTKAALTQRV PFLSICLSHQ VLCRQLGLPI RRKEQPNQGV QRQIDLFGTE       540
     RHVGFYNTFA AVTGSEWLDT PAGRVQISSD AVTGEVHALR AKRFASIQFH AESILTRDGV       600
     GIFAELLTPL ATGVPVLA                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page