(data stored in ACNUC30630 zone)

EMBL: CU458896.PE305

CU458896.PE305       Location/Qualifiers
FT   CDS             310222..312261
FT                   /transl_table=11
FT                   /locus_tag="MAB_0309"
FT                   /product="DNA polymerase III, subunit gamma/tau"
FT                   /note="Similar to Q25YZ4_MYCVN e-179"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60408"
FT                   /db_xref="GOA:B1MFK8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFK8"
FT                   /protein_id="CAM60408.1"
FT                   /translation="MAGARNRLWAPVPLLSVALYRKYRPATFAEVVGQEHVTGPLTTAL
FT                   DAGRINHAYLFSGPRGCGKTSSARILARSLNCVQGPTSTPCGTCESCVALAPNGSGNVD
FT                   VIELDAASHGGVDDTRELRDRAFYAPAQSRYRIFIIDEAHMVTTAGFNALLKIVEEPPE
FT                   HLIFVFATTEPEKVLPTIRSRTHHYPFRLLAPKTMRTLVEGICAQENVSVDDPVYPLVI
FT                   RAGAGSPRDTLSVLDQLLAGADEERVTYQRALSLLGVTDIALIDDAVDALAAGDGAAVF
FT                   GAIEGVMDAGHDPRRFGTDLLERFRDLIVLQAVPDAVERGVVDAPQDVLERMREQAERI
FT                   GPATLTRYAEVLHAGLGEMRGATAPRLLLEVVCARLLLPSATDAESAVLQRVERIEKRL
FT                   DMSVPEADGASAAPRFVRKSQAAAAPAAETAASPAPAPQPPRPAPEPPAPIPGPAPEPP
FT                   APRPEPEPAPEPEPAPEPTPIPEPPAPEPAPEPEPEPAPVPEPEPAREPRQPGALDTTA
FT                   VRNAWAEIRAKVRDRSRTTEVMLSGATVRAIDGNTLVLSHDSPPLAKRITESRNAEVIR
FT                   EALRDALGVNWEIRCDVGSAEAAAPAASRPAKAAPRVVTRPSRPTPDPEPVPEPEPEPP
FT                   SPEDEEEQMLAEAGQSEAGPRRDPEEVALELLQNELGARKIDPN"
     MAGARNRLWA PVPLLSVALY RKYRPATFAE VVGQEHVTGP LTTALDAGRI NHAYLFSGPR        60
     GCGKTSSARI LARSLNCVQG PTSTPCGTCE SCVALAPNGS GNVDVIELDA ASHGGVDDTR       120
     ELRDRAFYAP AQSRYRIFII DEAHMVTTAG FNALLKIVEE PPEHLIFVFA TTEPEKVLPT       180
     IRSRTHHYPF RLLAPKTMRT LVEGICAQEN VSVDDPVYPL VIRAGAGSPR DTLSVLDQLL       240
     AGADEERVTY QRALSLLGVT DIALIDDAVD ALAAGDGAAV FGAIEGVMDA GHDPRRFGTD       300
     LLERFRDLIV LQAVPDAVER GVVDAPQDVL ERMREQAERI GPATLTRYAE VLHAGLGEMR       360
     GATAPRLLLE VVCARLLLPS ATDAESAVLQ RVERIEKRLD MSVPEADGAS AAPRFVRKSQ       420
     AAAAPAAETA ASPAPAPQPP RPAPEPPAPI PGPAPEPPAP RPEPEPAPEP EPAPEPTPIP       480
     EPPAPEPAPE PEPEPAPVPE PEPAREPRQP GALDTTAVRN AWAEIRAKVR DRSRTTEVML       540
     SGATVRAIDG NTLVLSHDSP PLAKRITESR NAEVIREALR DALGVNWEIR CDVGSAEAAA       600
     PAASRPAKAA PRVVTRPSRP TPDPEPVPEP EPEPPSPEDE EEQMLAEAGQ SEAGPRRDPE       660
     EVALELLQNE LGARKIDPN                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page